(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0154

AL591973.LMO0154     Location/Qualifiers
FT   CDS             151186..151890
FT                   /transl_table=11
FT                   /gene="lmo0154"
FT                   /note="similar to high-affinity zinc ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q8YAH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH2"
FT                   /protein_id="CAC98369.1"
FT                   /translation="MKYIDIANIGFKYESEPVLENISFQVSAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVTFAKKNADGGRLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTTKDHAHVEKALKSVEMWDYRHKRIGELSGGQKQRICLARMFATDPDILILDE
FT                   PQTAMDKQSKIRFYNLLKHEAQVHGKAILMVTHDSEEMEDFVDKHIRLIRKEDVSWKCF
FT                   SMDLCKEPSKRP"
     MKYIDIANIG FKYESEPVLE NISFQVSAGE FIILTGENGA AKSTLLRIIL GILQPDKGSV        60
     TFAKKNADGG RLLTGYVPQQ IASFNAGFPS TVLELVRSGR FPNGKWFKRL TTKDHAHVEK       120
     ALKSVEMWDY RHKRIGELSG GQKQRICLAR MFATDPDILI LDEPQTAMDK QSKIRFYNLL       180
     KHEAQVHGKA ILMVTHDSEE MEDFVDKHIR LIRKEDVSWK CFSMDLCKEP SKRP             234
//

If you have problems or comments...

PBIL Back to PBIL home page