(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0155

AL591973.LMO0155     Location/Qualifiers
FT   CDS             151839..152645
FT                   /transl_table=11
FT                   /gene="lmo0155"
FT                   /note="similar to high-affinity zinc ABC transporter
FT                   (membrane protein)"
FT                   /db_xref="GOA:Q8YAH1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH1"
FT                   /protein_id="CAC98370.1"
FT                   /translation="MEMFLYGFMQRAFQASMIIAIIAPLLGVFLIIRRQSLMADTLSHV
FT                   SLAGVAFGLVLNVNPSVTTLIVVVIAALGIEYLRGVYVTYSELSIAILMAGGLAVALVL
FT                   MSLDQGGITTSVQQYLFGSIVTISKAQVQLLVILGVAIVVLFLVFKRFMFVLTFSEDVA
FT                   VAEGVPVRLISLLFSVVTGIAIAVIMPIAGALLVSALIILPAAIGMRISKGFLMCVISA
FT                   ILIGLVGMFSGLVSSYQLGTPPGATITLMFIILFIISTVVLKLIRK"
     MEMFLYGFMQ RAFQASMIIA IIAPLLGVFL IIRRQSLMAD TLSHVSLAGV AFGLVLNVNP        60
     SVTTLIVVVI AALGIEYLRG VYVTYSELSI AILMAGGLAV ALVLMSLDQG GITTSVQQYL       120
     FGSIVTISKA QVQLLVILGV AIVVLFLVFK RFMFVLTFSE DVAVAEGVPV RLISLLFSVV       180
     TGIAIAVIMP IAGALLVSAL IILPAAIGMR ISKGFLMCVI SAILIGLVGM FSGLVSSYQL       240
     GTPPGATITL MFIILFIIST VVLKLIRK                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page