(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0158

AL591973.LMO0158     Location/Qualifiers
FT   CDS             155993..156805
FT                   /transl_table=11
FT                   /gene="lmo0158"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAG8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG8"
FT                   /protein_id="CAC98373.1"
FT                   /translation="MYKIIAIDIDGTLLNDTHEITPAVRDSIKAAKAKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDEGDYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKIT
FT                   DVIKKLPENIKEKFYVVRSVPYNLEFLQKGVNKGSALASLADKLGVDQSEVMSIGDQEN
FT                   DITMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLILDR"
     MYKIIAIDID GTLLNDTHEI TPAVRDSIKA AKAKGVKVVL CTGRPLAGIK KSLIELDLLD        60
     EGDYAITFNG AVVLETASEK TLADITLNKT ELEEIYAFCH AENVNVTYFD GKNMYVPSRK       120
     ITEITCQDSL LLGTPLYHLP VEEAPESIHV SKVMLLDSPE KITDVIKKLP ENIKEKFYVV       180
     RSVPYNLEFL QKGVNKGSAL ASLADKLGVD QSEVMSIGDQ ENDITMIEYA GMGVAMGNAT       240
     EHIKEIANYT TTTNNEDGVA QAIQMLILDR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page