(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0159

AL591973.LMO0159     Location/Qualifiers
FT   CDS             157089..159470
FT                   /transl_table=11
FT                   /gene="lmo0159"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAG7"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG7"
FT                   /protein_id="CAC98374.1"
FT                   /translation="MSKNGNFLKKVGLAFLSILIVASTIFQTTVVKAATSYGSQFLNTV
FT                   ELLDKDGVPQTDFGYYDNMDVHYTWSIPNSTNVKAGDTMDFTLPSQLALATDLAFDVKD
FT                   SKGQVVGTATVKKATNQVTLVFSDYVEKHSDVKGELDFWTAFNQKVITGNETVDLVFPL
FT                   ENGTTVIDVEVGEKTPVSPTETLFKYGWVDASNPSLIHWVVRVNYAKVNIPNAVFTDII
FT                   GAKQTLNFDSIKAFHGTYSADRVFTAGAPISSTNFSATSDGFSVALGNLTDSVQISYTT
FT                   TTTDGGKSTQYDNTAKLAGTDFVTKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKAT
FT                   LEGAEFKLVDSKGTVLQENITTNASGQLSIADLKFDTYQLIETKAPTGYKLDTTPVEFT
FT                   IGENNQAITVTKENTLNTGSVELTKLDAATKATLAGATFELQDKEGNTLQTDLKTDENG
FT                   VLKVTDLVPGSYQFVETSAPTGYKLDNSPVSFEVIAGETDQVVKVTKENTLEVGSVELT
FT                   KLDSATKATLAGATFELQDKEGNTLQTDLKTDENGVLKVTDLVPGSYQFVETSAPTGYK
FT                   LDNSPVSFEVVAGETDQVVKVTKENTLEVGSVELTKLDSATKATLAGATFELQDKEGNT
FT                   LQTGLTTDENGVLKVTDLVPGTYQFVETKAPIGYELDTTPVSFEIVAGETDPIVKVTKE
FT                   NTLVPPTPVPPTPVPPTPVPPTPVPPTPLPPVPYEPTVPPTKPEVPVTPKKTENSEDSP
FT                   KTTPIRITQSLPKTGDTNSFAGLGVILIALSLSGLLLKRK"
     MSKNGNFLKK VGLAFLSILI VASTIFQTTV VKAATSYGSQ FLNTVELLDK DGVPQTDFGY        60
     YDNMDVHYTW SIPNSTNVKA GDTMDFTLPS QLALATDLAF DVKDSKGQVV GTATVKKATN       120
     QVTLVFSDYV EKHSDVKGEL DFWTAFNQKV ITGNETVDLV FPLENGTTVI DVEVGEKTPV       180
     SPTETLFKYG WVDASNPSLI HWVVRVNYAK VNIPNAVFTD IIGAKQTLNF DSIKAFHGTY       240
     SADRVFTAGA PISSTNFSAT SDGFSVALGN LTDSVQISYT TTTTDGGKST QYDNTAKLAG       300
     TDFVTKQTST WTPASGGGGE GGGTTGSVTL TKEDAKTKAT LEGAEFKLVD SKGTVLQENI       360
     TTNASGQLSI ADLKFDTYQL IETKAPTGYK LDTTPVEFTI GENNQAITVT KENTLNTGSV       420
     ELTKLDAATK ATLAGATFEL QDKEGNTLQT DLKTDENGVL KVTDLVPGSY QFVETSAPTG       480
     YKLDNSPVSF EVIAGETDQV VKVTKENTLE VGSVELTKLD SATKATLAGA TFELQDKEGN       540
     TLQTDLKTDE NGVLKVTDLV PGSYQFVETS APTGYKLDNS PVSFEVVAGE TDQVVKVTKE       600
     NTLEVGSVEL TKLDSATKAT LAGATFELQD KEGNTLQTGL TTDENGVLKV TDLVPGTYQF       660
     VETKAPIGYE LDTTPVSFEI VAGETDPIVK VTKENTLVPP TPVPPTPVPP TPVPPTPVPP       720
     TPLPPVPYEP TVPPTKPEVP VTPKKTENSE DSPKTTPIRI TQSLPKTGDT NSFAGLGVIL       780
     IALSLSGLLL KRK                                                          793
//

If you have problems or comments...

PBIL Back to PBIL home page