(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0160

AL591973.LMO0160     Location/Qualifiers
FT   CDS             159663..161378
FT                   /transl_table=11
FT                   /gene="lmo0160"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAG6"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG6"
FT                   /protein_id="CAC98375.1"
FT                   /translation="MKERTTMMSNLKKFGLAFLSVILLVNVIFQTNFVKAATNYGSDFL
FT                   KTVELLDADGNPQTDFGYYDSIKVHYTWEIPNSTNVKEGDTMEFVLPPELKIVTDLDFS
FT                   LKDHDGNTVGHVIAKKSTGQVVITFTDFVEKNSNISGYLDFWTNWDKSLVEGNENVPVE
FT                   FPVNGTTETIDVGVGGKNQIDPDESLYKYGWADAENPELIQWVVRVNYSKQNIQNAVYE
FT                   DFIGPKQVVDFNSIKAFHGEFDPDDNFTPGAEVPSSAITQTTDGFKVDLGNLTDSVKIS
FT                   YYTTSTDNGASPNYTNKGQLTGDNFIKQEIEVATPTSGGGGGGEGTTGSVELTKTDDSS
FT                   QKNPLEGAEFKLVNGAGATVQTGLKTNADGKLAISNLKYDTYQLIETKAPQGYVLDASP
FT                   VKFTIDDTHQSLFVSKENTAIKGSVSLEKVDRDTKSLLADAEFELQDKDGNTLKTNLKT
FT                   DQKGKLTVADLLPGEYQFVETKAPTGYILDTTPLKFKISTEALNVTVTKENTKKPEIPK
FT                   VPVPPKKPEKPDKIISEDSKQTALPKTGDSPLVNGWGLLLVAISASGLIALRRK"
     MKERTTMMSN LKKFGLAFLS VILLVNVIFQ TNFVKAATNY GSDFLKTVEL LDADGNPQTD        60
     FGYYDSIKVH YTWEIPNSTN VKEGDTMEFV LPPELKIVTD LDFSLKDHDG NTVGHVIAKK       120
     STGQVVITFT DFVEKNSNIS GYLDFWTNWD KSLVEGNENV PVEFPVNGTT ETIDVGVGGK       180
     NQIDPDESLY KYGWADAENP ELIQWVVRVN YSKQNIQNAV YEDFIGPKQV VDFNSIKAFH       240
     GEFDPDDNFT PGAEVPSSAI TQTTDGFKVD LGNLTDSVKI SYYTTSTDNG ASPNYTNKGQ       300
     LTGDNFIKQE IEVATPTSGG GGGGEGTTGS VELTKTDDSS QKNPLEGAEF KLVNGAGATV       360
     QTGLKTNADG KLAISNLKYD TYQLIETKAP QGYVLDASPV KFTIDDTHQS LFVSKENTAI       420
     KGSVSLEKVD RDTKSLLADA EFELQDKDGN TLKTNLKTDQ KGKLTVADLL PGEYQFVETK       480
     APTGYILDTT PLKFKISTEA LNVTVTKENT KKPEIPKVPV PPKKPEKPDK IISEDSKQTA       540
     LPKTGDSPLV NGWGLLLVAI SASGLIALRR K                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page