(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0162

AL591973.LMO0162     Location/Qualifiers
FT   CDS             162467..163459
FT                   /transl_table=11
FT                   /gene="lmo0162"
FT                   /note="similar to B. subtilis DNA polymerase III (delta'
FT                   subunit)"
FT                   /db_xref="GOA:Q8YAG4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG4"
FT                   /protein_id="CAC98377.1"
FT                   /translation="MGLQDELTMMQPVVMKIFSKSVRENRLSHGYLFEGTRGTGKKRTA
FT                   LWLAQSLFCLESTETELACGKCTNCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
     MGLQDELTMM QPVVMKIFSK SVRENRLSHG YLFEGTRGTG KKRTALWLAQ SLFCLESTET        60
     ELACGKCTNC TRIASHNHPD VHLLEPDGAS IKIDQVRALK QELSKRGMES DQKVVIIYDA       120
     EKMTVQSANS LLKFIEEPEG GLLLLFLTTN PGQILPTIQS RLQPVTFKSL TFDSLLASLT       180
     AAGISEQKAR IYASITGSVE EAKAFEESEW FSEARNVVIK LYEGIHHQGT SPLIIIQESW       240
     MPLFKEKDKM ALGLELLLLL YRDRLHLTLD ENYEPICTAQ KEMLGQDALR KSLSETTGEI       300
     EKILAAKSKL DSNMNTQLLM EQLVLEIQGR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page