(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0164

AL591973.LMO0164     Location/Qualifiers
FT   CDS             164309..164698
FT                   /transl_table=11
FT                   /gene="lmo0164"
FT                   /note="similar to B. subtilis YabA protein"
FT                   /db_xref="GOA:Q8YAG2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAG2"
FT                   /protein_id="CAC98379.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAETEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
     MDKKAIFDSV SNMEEQIGEL YQQLGDLKTN LGEMLEENNR LNLENEHLRR RLSLTDEATP        60
     EPKAETEAEH GVMAPNRKEA MQQMIELGEG YDNLVQLYKE GFHVCNVHFG SPRGNDEDCL       120
     FCLSLLNKK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page