(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0165

AL591973.LMO0165     Location/Qualifiers
FT   CDS             164756..165508
FT                   /transl_table=11
FT                   /gene="lmo0165"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAG1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG1"
FT                   /protein_id="CAC98380.1"
FT                   /translation="MEKLKLIGDERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFSYLP
FT                   VRKGKIIDLCSGNGIIPLLLSTRTEAQIVGVEIQERLADMAKRSISYNQLEEQIEMIEY
FT                   DLKNITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDTIRVAASL
FT                   LKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVLVEGIKDGKPGV
FT                   KYVPPVIVYDELGEYTPVIKEILYGESE"
     MEKLKLIGDE RLDYLLAENL RIIQSPSVFS FSIDAVLLAK FSYLPVRKGK IIDLCSGNGI        60
     IPLLLSTRTE AQIVGVEIQE RLADMAKRSI SYNQLEEQIE MIEYDLKNIT DLIPKERADI       120
     VTCNPPYFAT PDTSLKNTNE HFRIARHEVM CTLEDTIRVA ASLLKQGGKA NFVHRPERLL       180
     DIIDIMRKYR LEPKRIQFVH PRIDKEANTV LVEGIKDGKP GVKYVPPVIV YDELGEYTPV       240
     IKEILYGESE                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page