(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0166

AL591973.LMO0166     Location/Qualifiers
FT   CDS             165492..165764
FT                   /transl_table=11
FT                   /gene="lmo0166"
FT                   /note="similar to B. subtilis YazA protein"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAG0"
FT                   /protein_id="CAC98381.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVLRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLIQREEESE"
     MAKASEHFFY VLKCSDNSYY GGYTTDVLRR EAEHNAGIRC KYTKTRRPVK VIHFEKFETR        60
     SEATKAEAAF KKLSRKNKDA YLIQREEESE                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page