(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0167

AL591973.LMO0167     Location/Qualifiers
FT   CDS             165761..166642
FT                   /transl_table=11
FT                   /gene="lmo0167"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAF9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF9"
FT                   /protein_id="CAC98382.1"
FT                   /translation="MIKSQKSFSGTSQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPG
FT                   YELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EIRGEFCLIIEGNSNPQLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
     MIKSQKSFSG TSQGALYLVP TPIGNLEDMT FRAIRMLKEA DIIAAEDTRN TVKLLNHFEI        60
     TTRMTSYHQF TKENKEDNII QRMLGGEVVA LVSDAGMPSI SDPGYELVQS ALDANIPVIP       120
     LPGANAALTA LIASGLAPQP FYFYGFLPRQ NKERTQAIEK LAAREETWIL YESPHRLKET       180
     LKAIIKITGN DRKIVLCREL TKRFEEFLRG TVEDALNWAM DEEIRGEFCL IIEGNSNPQL       240
     AEEQLWWQEL DIKTHVSTVM EQENVSSKDA IKTVMKARNL PKREVYSAYH EIK              293
//

If you have problems or comments...

PBIL Back to PBIL home page