(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0168

AL591973.LMO0168     Location/Qualifiers
FT   CDS             complement(166687..166971)
FT                   /transl_table=11
FT                   /gene="lmo0168"
FT                   /note="similar to B. subtilis transcription regulatory
FT                   protein AbrB"
FT                   /db_xref="GOA:Q8YAF8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF8"
FT                   /protein_id="CAC98383.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIIL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAALMEEIKRRFGDTL"
     MKSTGMVRKI DELGRVVIPI EIRRTMNLNV KDPLEIFTDE DAIILKKYSA GLVCDVTGEF        60
     SVDNKKFVDG KLTLSKEGAA ALMEEIKRRF GDTL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page