(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0169

AL591973.LMO0169     Location/Qualifiers
FT   CDS             167086..167943
FT                   /transl_table=11
FT                   /gene="lmo0169"
FT                   /note="similar to a glucose uptake protein"
FT                   /db_xref="GOA:Q8YAF7"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF7"
FT                   /protein_id="CAC98384.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTATIIIASFVSGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
     MNIVIALIPA VMWGIMPLVV SKIGGKPRQQ IIGTTFGALA FAIGVFIFTN PEYTATIIIA        60
     SFVSGAFWSL GQMNQFRAFT QVGVSKTMPL STGMQLVGTS LFGVFAFHEW GTTSKLVLGF       120
     SALALIIIGI FLTSYQQHKD ENSGQNMKKG IITLLISSVG YVGYVVITRW FDISGWDAIL       180
     PQAIGMVVAG LLFSIKSEEK RFTKQTWLNM IPGVMWATGN LALLFSNKLV GIATGFSLSQ       240
     MGVVISTIGG ILFLGEKKTK KELILVIIGV VLVIIGGTMI GIAKS                       285
//

If you have problems or comments...

PBIL Back to PBIL home page