(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0175

AL591973.LMO0175     Location/Qualifiers
FT   CDS             complement(173309..174556)
FT                   /transl_table=11
FT                   /gene="lmo0175"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAF4"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF4"
FT                   /protein_id="CAC98390.1"
FT                   /translation="MFNKKKTIASLIVLSSLASQIALTPISALADTHDTNNIALLQNTN
FT                   ENVPYKYTSTLTFPTLTNQTQEDYKLEIKLALPSGMNYTDLQVSVGGEDITNQVGTTSF
FT                   DNSTNTVTFKFDKVTSWDSLSKAKVKFDWKTSYSGEGGEAKIDSLVATATATSEDKAGN
FT                   KSTSTGSLKPKDISAPVVKAEETEITYSPGSDVTEEQFLTDIHASVTDNYDSTISLTSN
FT                   FTSAVNLAVSGDYSVNVQATDKAGNVSNTLNVTVHVSTPAPVAGANITVNHLDSNGNKI
FT                   AESDTLTGVVNSNYQSESKKITGYTLETTPTNATGTFTDTPQTVDYIYKKDTVTPTPIT
FT                   VNPVEPVKPVNPVVNKPVTVKPANDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFG
FT                   ALLLLISAPLLLFKKK"
     MFNKKKTIAS LIVLSSLASQ IALTPISALA DTHDTNNIAL LQNTNENVPY KYTSTLTFPT        60
     LTNQTQEDYK LEIKLALPSG MNYTDLQVSV GGEDITNQVG TTSFDNSTNT VTFKFDKVTS       120
     WDSLSKAKVK FDWKTSYSGE GGEAKIDSLV ATATATSEDK AGNKSTSTGS LKPKDISAPV       180
     VKAEETEITY SPGSDVTEEQ FLTDIHASVT DNYDSTISLT SNFTSAVNLA VSGDYSVNVQ       240
     ATDKAGNVSN TLNVTVHVST PAPVAGANIT VNHLDSNGNK IAESDTLTGV VNSNYQSESK       300
     KITGYTLETT PTNATGTFTD TPQTVDYIYK KDTVTPTPIT VNPVEPVKPV NPVVNKPVTV       360
     KPANDNTNPS TSNSVEKTTY SSLPTTGDTD QSKSSTIFGA LLLLISAPLL LFKKK            415
//

If you have problems or comments...

PBIL Back to PBIL home page