(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0176

AL591973.LMO0176     Location/Qualifiers
FT   CDS             174834..175694
FT                   /transl_table=11
FT                   /gene="lmo0176"
FT                   /note="similar to glucose uptake protein"
FT                   /db_xref="GOA:Q8YAF3"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF3"
FT                   /protein_id="CAC98391.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAIGMVISALIMTHSGGTEKRFNKRTLLLTIPGVIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIILLKEKKTQKEMLFVIVGVVLVVLGGILIG
FT                   VAKGA"
     MNIMIALIPA LLWGTVPLII TKFGGSTRQQ TMGMTLGALT FAVIVFFFTD PVYTLKTVGI        60
     SFITGCLWTV GQMFQLQAFK IIGVSKAMPI STGMQLVGTT LCGVILFHEW DTTLRIILGF       120
     IALALIVGGI FLTSYAEKEE DGTNALKQGL ITLFISACGY VGLVVLIQGF KIDGINAILP       180
     QAIGMVISAL IMTHSGGTEK RFNKRTLLLT IPGVIWAAGN VAMVHANQLV GVATGFSLSQ       240
     LGVVISTIGG IILLKEKKTQ KEMLFVIVGV VLVVLGGILI GVAKGA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page