(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0180

AL591973.LMO0180     Location/Qualifiers
FT   CDS             180052..180900
FT                   /transl_table=11
FT                   /gene="lmo0180"
FT                   /note="similar to sugar ABC transporter, permease protein"
FT                   /db_xref="GOA:Q8YAF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF0"
FT                   /protein_id="CAC98395.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVIVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
     MKTEKSGSPK WQLFKNILTY TIICLGGIIM LMPFVWMVST AFKTGAANMV LPPQFIPKEP        60
     TTANFTQVFE MFPMLRFLVN SVIVAVVTTL GQMLFCSMAA YAFARIPFWG RDKLFLLYLA       120
     TMMVPAQVTM IPQFILMKQF GWLDSYAGLI VPALFSVFGT FLLRQAFMGI PKELEEAAFM       180
     DGANHFTIFR KVILPLAKPT FATLGILTFM QSWNSYLWPL IVTSSQEMAT LPLGLSLLQG       240
     RYGTNYGLMM AGVLISVIPI LAVYLFAQKY FIQGMAMSGM KE                          282
//

If you have problems or comments...

PBIL Back to PBIL home page