(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0181

AL591973.LMO0181     Location/Qualifiers
FT   CDS             180928..182184
FT                   /transl_table=11
FT                   /gene="lmo0181"
FT                   /note="similar to sugar ABC transporter, sugar-binding
FT                   protein"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="PDB:5F7V"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE9"
FT                   /protein_id="CAC98396.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTIN
FT                   SPENVEALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
     MKKGLLLLMV VVLSVFGLSA CGGGSSSGDK TEITYYQFSA PADGKALDEM VKEFEKQNPD        60
     IKVNVQTIAF NDYFTKLQTQ IAGGDAPDAF ELNYETFMQY AEKGVLADLT SYIEKDKDFD       120
     PSTLNKQAYD AFKYDGKQYG MVESFSNVVT IYNKDLFDKA GVEYPTADWT WKDEEAAAKK       180
     LTDAKNKVWG TSQPVTMNEF YKVAAQNGGS IFNEDLTETT INSPENVEAL THLTNEVTDS       240
     KVAPSPADLS GQLPEDLFMN GQIAMLHTGI WLFDMFQDAP FKWDVQVEAG NTQKATHFFA       300
     NGIGVSKDSD KKEAAFKFAS FMSANEEAAK IRIDNNWELP ATENKEILQP YLDATPPDNR       360
     EAVFESLQYM VLPPVVKDWN KISDYTNSEF EKVLNGDSTP EKALKNSEDN INKTMGFK         418
//

If you have problems or comments...

PBIL Back to PBIL home page