(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0186

AL591973.LMO0186     Location/Qualifiers
FT   CDS             190690..191916
FT                   /transl_table=11
FT                   /gene="lmo0186"
FT                   /note="similar to B. subtilis YabE protein"
FT                   /db_xref="GOA:Q8YAE4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE4"
FT                   /protein_id="CAC98401.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGKKVVEYKVTFENGKEKKRDVIKENVTSNKTDKV
FT                   VVRGTKEKVVATPVSNVSTSSATSSSSSSASSTPSGGKTYKMESTAYSGGGTTAYGINL
FT                   SANPGLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGR
FT                   RMVTVKVLN"
     MTMENSSNVA QSSKWKLPIM IAGFVIVVAL VFYFVFEGTK NDITIVNAGE KIESRTHAKT        60
     VSEALDEAGI KVSERDEIAP GKNAEIKDGM EIKYLPARQI TINDNGTKKD VWSTKANVAD       120
     LLKDENITTR PQDVLNVALD TKLKNGLEVN INRAIQLSLQ NGAKKDTVWT TKTKVSDLLA       180
     EKNIKLDQDD RVSPAKDSNL KEKMTVEVTY VNSKAEKKNE QVKFETVYKE DDSLNKGVEK       240
     VVQEGKNGKK VVEYKVTFEN GKEKKRDVIK ENVTSNKTDK VVVRGTKEKV VATPVSNVST       300
     SSATSSSSSS ASSTPSGGKT YKMESTAYSG GGTTAYGINL SANPGLKVIA VDPRIIPLGS       360
     KVWVEGYGEA IAGDTGGAIK GNIVDVYFPN ESQCYSWGRR MVTVKVLN                    408
//

If you have problems or comments...

PBIL Back to PBIL home page