(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0187

AL591973.LMO0187     Location/Qualifiers
FT   CDS             192018..192593
FT                   /transl_table=11
FT                   /gene="lmo0187"
FT                   /note="similar to B. subtilis YabF protein"
FT                   /db_xref="GOA:Q8YAE3"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE3"
FT                   /protein_id="CAC98402.1"
FT                   /translation="MSGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGAPTEKQFISKDILVHLGLLGGVGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEEQLVAACQKIMQEEENE"
     MSGKPVIHEF IVVEGRDDTT AINRSVIADT IETNGSALSQ ETIEKIRHAQ ELRGVIIFTD        60
     PDFPGEKIRK QIDSAVPGCK HAFINRQDAL PKAGRGLGVE HASSANIREA LENFHTSGAP       120
     TEKQFISKDI LVHLGLLGGV GAKERREKIG NILKIGYTNG KQLQTRLESF AISEEQLVAA       180
     CQKIMQEEEN E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page