(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0189

AL591973.LMO0189     Location/Qualifiers
FT   CDS             193593..193850
FT                   /transl_table=11
FT                   /gene="lmo0189"
FT                   /note="highly similar to B. subtilis Veg protein"
FT                   /db_xref="GOA:Q92F78"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q92F78"
FT                   /protein_id="CAC98404.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
     MPKTIASIKT NLDSRLGKAL TLKANGGRKK TIERCGILAE TYPSVFIVEL DQDENNFERV        60
     SYSYTDILTD AVELVFTDDN KELAL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page