(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0190

AL591973.LMO0190     Location/Qualifiers
FT   CDS             193989..194870
FT                   /transl_table=11
FT                   /gene="lmo0190"
FT                   /note="similar to B. subtilis YabH protein"
FT                   /db_xref="GOA:Q8YAE1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE1"
FT                   /protein_id="CAC98405.1"
FT                   /translation="MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLER
FT                   LDEDKIVLDVKAHFIPEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNVIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPG
FT                   CWIVLAKPSISVSTPTIYKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTL
FT                   EKNPQVKRIKDRMLAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSEGENDTNINY"
     MKISITAPAK INLSLDALYK REDGYHEVEM VMTTIDLADR LYLERLDEDK IVLDVKAHFI        60
     PEDRRNLIYQ AALLLKKRFD VKMGVRITID KHIPVSAGLA GGSSDAAAAL KGLNVIWELG       120
     LSIEELAEIS SEIGSDIAFC VYGGTALATG RGEKISALPN IPGCWIVLAK PSISVSTPTI       180
     YKELQVDNVE HPDTQKMIES IKNGDLDGIF AATGNVLESV TLEKNPQVKR IKDRMLAFGA       240
     EAALMSGSGP TVFALIKQYS RAKRVYNGLR GFCEEVYMVR PWSEGENDTN INY              293
//

If you have problems or comments...

PBIL Back to PBIL home page