(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0194

AL591973.LMO0194     Location/Qualifiers
FT   CDS             197512..198204
FT                   /transl_table=11
FT                   /gene="lmo0194"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD7"
FT                   /protein_id="CAC98409.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVEQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDEGSYHLDDVDVFKLSDNKLSEIRNKKIGFIFQQFNLLPKLSA
FT                   FENVELPLIYAGLSVSAREKAAIECLEKVGLLEKRRNLPTQLSGGQQQRVAIARALAGK
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEEATQA"
     MPKPLIDMKN LTKTYTLGGE TFKALDDVTF TVEQGEFLSI VGPSGSGKST LMNMIGCLDV        60
     PDEGSYHLDD VDVFKLSDNK LSEIRNKKIG FIFQQFNLLP KLSAFENVEL PLIYAGLSVS       120
     AREKAAIECL EKVGLLEKRR NLPTQLSGGQ QQRVAIARAL AGKPQILLAD EPTGALDSKT       180
     GKEVMGILQE LNRAGNTIVM ITHDPTIASY GTRSIRIQDG KLFHEEATQA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page