(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0195

AL591973.LMO0195     Location/Qualifiers
FT   CDS             198201..199409
FT                   /transl_table=11
FT                   /gene="lmo0195"
FT                   /note="similar to membrane protein (putative ABC
FT                   transporter component)"
FT                   /db_xref="GOA:Q8YAD6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD6"
FT                   /protein_id="CAC98410.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKNSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGV
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
     MNVLQSMKMA WKQLKASKLR SFLTMLGIII GVASVILLVS LGNGVTQEVD DQMGDLGSNL        60
     ITVVNSSVNP NDKYTYDEVM KYQNIDGVKS VSPELSGQVN ATFDYKNSSN KVIGTNDQYK       120
     AARSLEMKEG RFLLPIDTEY GQKVAVIGST VASDLFGFGD PIGETIRLNG MPYKVVGVLK       180
     EKGASMMGSS DDQIFIPISS AQRLLKDTNV RTIYVETKSA EDVDFVVNTL ESRLAIKFGD       240
     EKEQEKNASS AQMGPSYQVI NQQEILNAFN TISTTLTTAL GAIAAISLVV GGIGIMNIML       300
     VSVSERTREI GIRKALGAKK RAILLQFLIE SIVISVCGGV IGIIIGVSGA LIFGSVAGIS       360
     SGITAGTIIF SFVFSLCIGV IFGIAPANKA SKLRPIDALR SE                          402
//

If you have problems or comments...

PBIL Back to PBIL home page