(data stored in SCRATCH3701 zone)

EMBL: AL591973.QOXA

AL591973.QOXA        Location/Qualifiers
FT   CDS             16219..17325
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /product="AA3-600 quinol oxidase subunit II"
FT                   /db_xref="GOA:Q8YAV0"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006332"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV0"
FT                   /protein_id="CAC98228.1"
FT                   /translation="MSKVLKSLLLTALLGVTGLISGCGDLTVLNPKGPVAKGQSDLIIY
FT                   SIIFMLVIVLTIFVLFTIMLVKYRERKDISNYEPDMHGSKKLEIFWTLIPVAIVIALAI
FT                   PTVKTIYAGEEAPKVTSHKDPIIIYATSADWKWIFSYPDESIETVNYVNIPTDRPVLFK
FT                   LTSADTMTSFWVPQLGGQKYAMSGMTMNLYLQADEVGTYKGRNANFNGEGFADQRFDVV
FT                   AQSEKDFKKWAKETKASSPVITQDIYDRLLIPGSSKKKTYSGTHLAFVDVAADPEYVFY
FT                   AYKRFGYEMTNPHNPNTKSTISDEPMLPVRPVTVTNPQFERHDMKPQIIKNGEGYHEDK
FT                   HREDEMKKMEEDIQTNEFNKKESDDAGK"
     MSKVLKSLLL TALLGVTGLI SGCGDLTVLN PKGPVAKGQS DLIIYSIIFM LVIVLTIFVL        60
     FTIMLVKYRE RKDISNYEPD MHGSKKLEIF WTLIPVAIVI ALAIPTVKTI YAGEEAPKVT       120
     SHKDPIIIYA TSADWKWIFS YPDESIETVN YVNIPTDRPV LFKLTSADTM TSFWVPQLGG       180
     QKYAMSGMTM NLYLQADEVG TYKGRNANFN GEGFADQRFD VVAQSEKDFK KWAKETKASS       240
     PVITQDIYDR LLIPGSSKKK TYSGTHLAFV DVAADPEYVF YAYKRFGYEM TNPHNPNTKS       300
     TISDEPMLPV RPVTVTNPQF ERHDMKPQII KNGEGYHEDK HREDEMKKME EDIQTNEFNK       360
     KESDDAGK                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page