(data stored in SCRATCH3701 zone)

EMBL: AL591973.QOXB

AL591973.QOXB        Location/Qualifiers
FT   CDS             17344..19323
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /product="AA3-600 quinol oxidase subunit I"
FT                   /db_xref="GOA:Q8YAU9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014233"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU9"
FT                   /protein_id="CAC98229.1"
FT                   /translation="MKWNEFIVTGDPMILGAQISIVLVSIGVVALLTYTKKWKWLMKEW
FT                   ISSVDHKKIGIMYLLAAVLMFFRGGVDALMMRTQLALPDMKFLDAQHYNEVFSTHGTIM
FT                   ILFMAMPFIIGLMNIAVPLQIGARDVAFPFLNNLSFWTFFMGAMLFNLSFVIGGSPDAG
FT                   WTNYAPLATDFSAGYGINFYLLGVQIAGIGTLMTGINFFVTILRMRTKGMTLMKMPMFT
FT                   WSSLITSLIIIFAFPVLTVALALMSFDRLFGTAFFTLTNGGLPMMWANLFWVWGHPEVY
FT                   IVILPAFGIFSEIISTFSRKKLFGYPAMVAAMAVISLLSFLVWVHHFFTMGSGALVNSF
FT                   FSITTMMIAIPTGIKIFNWLFTMYKGRITFTTPMLWSLAFIPNFVVGGVTGVMLAMAAA
FT                   DYQYHNTYFLVSHFHYVLIAGTVFSCFAGLTYWYPKMVGYRLNEKIGKWFFWIFVVGFN
FT                   VCFFPQYFLGLDGMPRRIYTYVQGDGWTTLNFISTVGGFLMGVAFLVLCYNIYYSYKNS
FT                   KREVTGDPWDARTLEWATSSAVPPKYNFAVLPEWNDLDDFWNRKQKGDPYVNDKNYKPI
FT                   HMPSNTMVGFVMSVFFFIAGFGLVFYWYWMGIIGLVGILGCMIYRSFQNNDGYHVEVEE
FT                   IKATEEHNARELATGVKEGNPWNL"
     MKWNEFIVTG DPMILGAQIS IVLVSIGVVA LLTYTKKWKW LMKEWISSVD HKKIGIMYLL        60
     AAVLMFFRGG VDALMMRTQL ALPDMKFLDA QHYNEVFSTH GTIMILFMAM PFIIGLMNIA       120
     VPLQIGARDV AFPFLNNLSF WTFFMGAMLF NLSFVIGGSP DAGWTNYAPL ATDFSAGYGI       180
     NFYLLGVQIA GIGTLMTGIN FFVTILRMRT KGMTLMKMPM FTWSSLITSL IIIFAFPVLT       240
     VALALMSFDR LFGTAFFTLT NGGLPMMWAN LFWVWGHPEV YIVILPAFGI FSEIISTFSR       300
     KKLFGYPAMV AAMAVISLLS FLVWVHHFFT MGSGALVNSF FSITTMMIAI PTGIKIFNWL       360
     FTMYKGRITF TTPMLWSLAF IPNFVVGGVT GVMLAMAAAD YQYHNTYFLV SHFHYVLIAG       420
     TVFSCFAGLT YWYPKMVGYR LNEKIGKWFF WIFVVGFNVC FFPQYFLGLD GMPRRIYTYV       480
     QGDGWTTLNF ISTVGGFLMG VAFLVLCYNI YYSYKNSKRE VTGDPWDART LEWATSSAVP       540
     PKYNFAVLPE WNDLDDFWNR KQKGDPYVND KNYKPIHMPS NTMVGFVMSV FFFIAGFGLV       600
     FYWYWMGIIG LVGILGCMIY RSFQNNDGYH VEVEEIKATE EHNARELATG VKEGNPWNL        659
//

If you have problems or comments...

PBIL Back to PBIL home page