(data stored in SCRATCH3701 zone)

EMBL: AL591973.QOXC

AL591973.QOXC        Location/Qualifiers
FT   CDS             19311..19922
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /product="AA3-600 quinol oxidase subunit III"
FT                   /db_xref="GOA:Q8YAU8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014246"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU8"
FT                   /protein_id="CAC98230.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
     MESVETNKNL PIEYRSEQGR LNILGFWIFL GAEIALFATL FATYFVMRKA GSNAGHPPAE        60
     MFELWLVLIM TFLLLTSSFT CGLAIGEMRK GNVKMLTIYS IITLILGAGF VGFELYEFAH       120
     YVTEGVTMQV GSYWSAFFVL LGTHGLHVTV GIFWISFILI QIKMHGLTPK TASKVFISSL       180
     YWHFLDVVWI FIFTGVYLLG MVN                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page