(data stored in SCRATCH3701 zone)

EMBL: AL591973.RPLI

AL591973.RPLI        Location/Qualifiers
FT   CDS             56815..57261
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="GOA:Q8YAR2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR2"
FT                   /protein_id="CAC98268.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQTLEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
     MKVIFLKDVK GKGKKGETKN VADGYANNFL IKNGYAVEAN NAALSTLSAQ KKKEDKLAAE        60
     ELAEAKALKE KMENLTVELK AKSGEGGRLF GSITSKQIAQ TLEKTHGIKI DKRKMDLPEA       120
     IRALGHTKVP VKLHHEVTAT LDVHVSEE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page