(data stored in SCRATCH3701 zone)

EMBL: AL591973.RPSF

AL591973.RPSF        Location/Qualifiers
FT   CDS             49585..49878
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="GOA:Q8YAR9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR9"
FT                   /protein_id="CAC98259.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
     MARKYEIMYI IRPNIEEDEK KAVVERFDGI LTENGAEIIE SKEWGKRRLA YEINDYRDGF        60
     YHIVKLNADK ADSINEFDRL AKISDDIIRH MVIKEEA                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page