(data stored in SCRATCH3701 zone)

EMBL: AL591973.RPSR

AL591973.RPSR        Location/Qualifiers
FT   CDS             50514..50753
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="GOA:P66461"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66461"
FT                   /protein_id="CAC98261.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
     MAGGRRGGRR RKKVCYFTSN GITHIDYKDV ELLKKFVSER GKILPRRVTG TSAKYQRKLT        60
     VAIKRSRQMA LLPFVAEEK                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page