(data stored in SCRATCH3701 zone)

EMBL: AL591973.SSB

AL591973.SSB         Location/Qualifiers
FT   CDS             49934..50470
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /note="highly similar to single-strand binding protein
FT                   (SSB)"
FT                   /db_xref="GOA:Q8YAR8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR8"
FT                   /protein_id="CAC98260.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
     MMNRVVLVGR LTKDPELRYT PAGVAVATFT LAVNRTFTNQ QGEREADFIN CVVWRKPAEN        60
     VANFLKKGSM AGVDGRVQTR NYEGNDGKRV YVTEIVAESV QFLEPRNSNG GGGNNYQSGN       120
     NNNNYNSGGN NFGQAPTNNG GFGQDQQQSQ NQNYQSTNND PFASDGKPID ISDDDLPF         178
//

If you have problems or comments...

PBIL Back to PBIL home page