(data stored in ACNUC9435 zone)

EMBL: AL596167.ACKA2

AL596167.ACKA2       Location/Qualifiers
FT   CDS             182511..183704
FT                   /transl_table=11
FT                   /gene="AckA2"
FT                   /note="similar to acetate kinase"
FT                   /db_xref="GOA:Q92CN9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CN9"
FT                   /protein_id="CAC96363.1"
FT                   /translation="MHKIMAINAGSSSLKFQIFTMPGEEVLVKGLIERIGLPDAIFNMS
FT                   FQNEKIKETRAINNHGEAVEILLEQLKTHQVINDLNEITGVGHRVAHGGEAFVSSCIVT
FT                   DDVVKGIEDVTSLAPLHNPANIIGIKTFRELLPNAVSVAVFDTAFHQTIPEENFLYALP
FT                   YELYEKHHIRKYGFHGTSHKYVAGKAAEVLKKPLEKLKIISCHLGNGASVCAIEAGKSV
FT                   NTSMGFTPNAGLMMGTRSGTIDATIIPYLVDELGYSLDEVTHMMSSESGVLGVSGISSD
FT                   FRDIEIAANEGNSRALLTLRMFTGQICNYIGAYASAMNGCDALLFTAGVGENSPLIRKM
FT                   VTEQLSYLGVTCNVTKNNAGDMIISNDDEAVKVCIIPTNEELMIARDVEKYTKQTIS"
     MHKIMAINAG SSSLKFQIFT MPGEEVLVKG LIERIGLPDA IFNMSFQNEK IKETRAINNH        60
     GEAVEILLEQ LKTHQVINDL NEITGVGHRV AHGGEAFVSS CIVTDDVVKG IEDVTSLAPL       120
     HNPANIIGIK TFRELLPNAV SVAVFDTAFH QTIPEENFLY ALPYELYEKH HIRKYGFHGT       180
     SHKYVAGKAA EVLKKPLEKL KIISCHLGNG ASVCAIEAGK SVNTSMGFTP NAGLMMGTRS       240
     GTIDATIIPY LVDELGYSLD EVTHMMSSES GVLGVSGISS DFRDIEIAAN EGNSRALLTL       300
     RMFTGQICNY IGAYASAMNG CDALLFTAGV GENSPLIRKM VTEQLSYLGV TCNVTKNNAG       360
     DMIISNDDEA VKVCIIPTNE ELMIARDVEK YTKQTIS                                397
//

If you have problems or comments...

PBIL Back to PBIL home page