(data stored in ACNUC9435 zone)

EMBL: AL596167.CBID

AL596167.CBID        Location/Qualifiers
FT   CDS             205726..206847
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /note="similar to cobalamin biosynthesis protein  CbiD"
FT                   /db_xref="GOA:Q92CL4"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL4"
FT                   /protein_id="CAC96388.1"
FT                   /translation="MEDFIYYNGKKYRKGYTTGTCAAAAAKACVEMIENQEEVSAVKVT
FT                   TTGGTILEIPVAYQQFSEKKATAAVQKDGGDDIDATHGMWIFVDVELTDSPEVTLDGGV
FT                   GIGRATQKGISVEVGEAAINPAPRKNILATVRESLGENRGATILVYAPEGEERAKRTMN
FT                   SNLGIIGGISILGTTGIVTPMSDEGWKKSLSMELEMKRNQGLDQIILVPGNYGDDFVQN
FT                   TLGFASDNIVSMSNFVGYMLKETQRLAFKKVLMVGHFGKLVKVSAGIFTTYSKDADARA
FT                   EILVANLALLGAPLSLLQEVEKCNTTEAAGELIEAAGFTQVYEVIAQKIKARSERFLKF
FT                   TKPSVEIDVVTFSTERGLLAATKDIEVLREEWR"
     MEDFIYYNGK KYRKGYTTGT CAAAAAKACV EMIENQEEVS AVKVTTTGGT ILEIPVAYQQ        60
     FSEKKATAAV QKDGGDDIDA THGMWIFVDV ELTDSPEVTL DGGVGIGRAT QKGISVEVGE       120
     AAINPAPRKN ILATVRESLG ENRGATILVY APEGEERAKR TMNSNLGIIG GISILGTTGI       180
     VTPMSDEGWK KSLSMELEMK RNQGLDQIIL VPGNYGDDFV QNTLGFASDN IVSMSNFVGY       240
     MLKETQRLAF KKVLMVGHFG KLVKVSAGIF TTYSKDADAR AEILVANLAL LGAPLSLLQE       300
     VEKCNTTEAA GELIEAAGFT QVYEVIAQKI KARSERFLKF TKPSVEIDVV TFSTERGLLA       360
     ATKDIEVLRE EWR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page