(data stored in ACNUC9435 zone)

EMBL: AL596167.CBIG

AL596167.CBIG        Location/Qualifiers
FT   CDS             208741..209772
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /note="similar to cobalamin biosynthesis protein G CbiG"
FT                   /db_xref="GOA:Q92CL0"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL0"
FT                   /protein_id="CAC96392.1"
FT                   /translation="MNTDKIAIIAVTERGRDLAISLTKTLPGTVFVPEKHQNEQTAVLT
FT                   PNFGTAMREMFTTHQALICIMATGIAVRTLAPVIQDKLSDPAVIVMDEYGQFIISLLSG
FT                   HVGGANELTEQIAAITGGAAVITTATDRANVAAIDNIAKEIDGYLPDFKATTKRINGLL
FT                   AAGKEVSLHVDEPFEVDSRGFTNKEISPQIFISTKYNLPDTKIERIQLVPRKFVLGIGC
FT                   RKGVSAETMEEVFTHFCEQENIHPRAFREIHSITLKAEEPAILQLAKKWNIHFIVHSAE
FT                   ELQTVAEKYPTSEFVLKTVKVGNVALSSADIGSNGNVITKRFAENGVTFAAGKLIKNNE
FT                   VAK"
     MNTDKIAIIA VTERGRDLAI SLTKTLPGTV FVPEKHQNEQ TAVLTPNFGT AMREMFTTHQ        60
     ALICIMATGI AVRTLAPVIQ DKLSDPAVIV MDEYGQFIIS LLSGHVGGAN ELTEQIAAIT       120
     GGAAVITTAT DRANVAAIDN IAKEIDGYLP DFKATTKRIN GLLAAGKEVS LHVDEPFEVD       180
     SRGFTNKEIS PQIFISTKYN LPDTKIERIQ LVPRKFVLGI GCRKGVSAET MEEVFTHFCE       240
     QENIHPRAFR EIHSITLKAE EPAILQLAKK WNIHFIVHSA EELQTVAEKY PTSEFVLKTV       300
     KVGNVALSSA DIGSNGNVIT KRFAENGVTF AAGKLIKNNE VAK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page