(data stored in ACNUC9435 zone)

EMBL: AL596167.CBIQ

AL596167.CBIQ        Location/Qualifiers
FT   CDS             215220..215897
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /note="similar to cobalt transport protein Q"
FT                   /db_xref="GOA:Q92CK2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK2"
FT                   /protein_id="CAC96400.1"
FT                   /translation="MLTIDKYAYQNRWIAFSPSLKALFYVAILILALTGPVLVQAILFL
FT                   CMVPLTLYVVKIHFKQYLKWLLLPFSFLLFSLLSILISISKDPSSFLASISIGSFYLGI
FT                   SDVTITTATQVFFRSIACLAATYFFVLTVPVVQLTKVMKQIFIPKVLIELTILIYRFIF
FT                   IFLEEAAAIRKAQSLRFGYHGIKNSYRSFGMLVNTLFNRVMKRYNEMVITLDVKLYQGE
FT                   FHI"
     MLTIDKYAYQ NRWIAFSPSL KALFYVAILI LALTGPVLVQ AILFLCMVPL TLYVVKIHFK        60
     QYLKWLLLPF SFLLFSLLSI LISISKDPSS FLASISIGSF YLGISDVTIT TATQVFFRSI       120
     ACLAATYFFV LTVPVVQLTK VMKQIFIPKV LIELTILIYR FIFIFLEEAA AIRKAQSLRF       180
     GYHGIKNSYR SFGMLVNTLF NRVMKRYNEM VITLDVKLYQ GEFHI                       225
//

If you have problems or comments...

PBIL Back to PBIL home page