(data stored in ACNUC9435 zone)

EMBL: AL596167.COBD

AL596167.COBD        Location/Qualifiers
FT   CDS             183718..184803
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /note="similar to Salmonella typhimurium CobD protein and
FT                   to histidinol-phosphate aminotransferase"
FT                   /db_xref="GOA:Q92CN8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN8"
FT                   /protein_id="CAC96364.1"
FT                   /translation="MKITTAMHGGNYNELAKQHGLTKEMILDFSANINPLGVPASLKQT
FT                   ITANLDKLVEYPEPDYLALRARIASFHQLDLANVIPGNGATELIFGIAKVTKAQKVLLL
FT                   APTFAEYERAFFDAEIIYAELTKETHFAAAETVLEMIKRETDLEAVCLCNPNNPTGQLI
FT                   SQQEMIQIAELCEERNIYLIIDEAFMDFLEGNETISMINYLGSFPHLAIIRAFTKFFAI
FT                   PGLRLGYLLTKNDLLAEALLQMREPWSINTFADMAGQVLLDDTDYITQTYNWISAERDF
FT                   LYQELSKFSELTVYRPSVNYIFFHLETPLDLRKELLLKGIFIRSCANYRGLTENYYRVA
FT                   VKARCDNTKLIRALEVIFSGN"
     MKITTAMHGG NYNELAKQHG LTKEMILDFS ANINPLGVPA SLKQTITANL DKLVEYPEPD        60
     YLALRARIAS FHQLDLANVI PGNGATELIF GIAKVTKAQK VLLLAPTFAE YERAFFDAEI       120
     IYAELTKETH FAAAETVLEM IKRETDLEAV CLCNPNNPTG QLISQQEMIQ IAELCEERNI       180
     YLIIDEAFMD FLEGNETISM INYLGSFPHL AIIRAFTKFF AIPGLRLGYL LTKNDLLAEA       240
     LLQMREPWSI NTFADMAGQV LLDDTDYITQ TYNWISAERD FLYQELSKFS ELTVYRPSVN       300
     YIFFHLETPL DLRKELLLKG IFIRSCANYR GLTENYYRVA VKARCDNTKL IRALEVIFSG       360
     N                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page