(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTA

AL596167.DLTA        Location/Qualifiers
FT   CDS             complement(31637..33169)
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /product="D-alanine-activating enzyme (dae),
FT                   D-alanine-D-alanyl carrier protein ligase (dcl)"
FT                   /db_xref="GOA:Q92D47"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D47"
FT                   /protein_id="CAC96204.1"
FT                   /translation="MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFL
FT                   LNTLNSDKEKPIIVYGHMSPLMLIAFLGTIKSGRAYVPVDVSMPVERIEQIKKAADPAL
FT                   FICTEELPSNLTITGCPVLTQDQLMDALEKHFEEVPDPAECVKNDDNYYIIYTSGSTGN
FT                   PKGVQISQNNLVSFSNWILQDFSLRQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLD
FT                   KTITANMKDLYREIPAQNFDVWVSTPSFADLCLLDDNFNQENNPNLTRFLFCGEVLAKK
FT                   TASELLDRFPDAVIYNTYGPTEATVAVTQVKVTRELIDAYPSLPLGVIKPDMRLHIVDQ
FT                   ETGEILPEGEKGEIILIGASVSKGYLNEPEKTDQVFFDYKGYQAYHTGDSGVIKDGYLF
FT                   FQGRLDFQIKLHGYRIELEDIENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPSSHDF
FT                   EKEYQLSAAIKNELKEFMPAYMIPRKWIYKTEFPLTMNGKIDRKALNSEVNK"
     MTTSIIERID AWAEKTPDFP CYEYAGTRLS YKELKRQSDA FGSFLLNTLN SDKEKPIIVY        60
     GHMSPLMLIA FLGTIKSGRA YVPVDVSMPV ERIEQIKKAA DPALFICTEE LPSNLTITGC       120
     PVLTQDQLMD ALEKHFEEVP DPAECVKNDD NYYIIYTSGS TGNPKGVQIS QNNLVSFSNW       180
     ILQDFSLRQG LRFLNQAPFS FDLSVMDLYP SLLSGGTLVP LDKTITANMK DLYREIPAQN       240
     FDVWVSTPSF ADLCLLDDNF NQENNPNLTR FLFCGEVLAK KTASELLDRF PDAVIYNTYG       300
     PTEATVAVTQ VKVTRELIDA YPSLPLGVIK PDMRLHIVDQ ETGEILPEGE KGEIILIGAS       360
     VSKGYLNEPE KTDQVFFDYK GYQAYHTGDS GVIKDGYLFF QGRLDFQIKL HGYRIELEDI       420
     ENNLKKVSYI QNCAIIPKMK DEKVDMLVAQ VIPSSHDFEK EYQLSAAIKN ELKEFMPAYM       480
     IPRKWIYKTE FPLTMNGKID RKALNSEVNK                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page