(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTB

AL596167.DLTB        Location/Qualifiers
FT   CDS             complement(30456..31640)
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /product="DltB protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q92D48"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D48"
FT                   /protein_id="CAC96203.1"
FT                   /translation="MSTPYGTILYFGVLLLFFIPIIVAGLLGKRLPIYNAFVTLVFLYF
FT                   LFAANPVQGVTFIFFVFWQLALVRLYFHYRQEKKQNHGGVFVIAVILSILPLVISKVVP
FT                   ILGDQVTMVGFLGISYLTFKATQMIIEIRDNLIKQYNAWDFVNFLLFFPTISSGPIDRF
FT                   RRFKKDVDNPPSKEAYVALLNRGIFLIFLGFLYKFIIAYLVNKHFVVPLDIAITHNVDT
FT                   TTSLIGYMYAYSMYLFFDFAGYSAFAVGVSYLLGVQTPMNFNKPFAARNIKEFWNRWHM
FT                   TLSFWFRDYVFMRFVLWLTKKKWFKSKFTIAYIAYFVNFFIMGVWHGLHWYYIVYGLYQ
FT                   ATLIVGFDLIERFNKKHKFYPKNKITYVIGVIITFQFVCFGFLIFSGILDKINF"
     MSTPYGTILY FGVLLLFFIP IIVAGLLGKR LPIYNAFVTL VFLYFLFAAN PVQGVTFIFF        60
     VFWQLALVRL YFHYRQEKKQ NHGGVFVIAV ILSILPLVIS KVVPILGDQV TMVGFLGISY       120
     LTFKATQMII EIRDNLIKQY NAWDFVNFLL FFPTISSGPI DRFRRFKKDV DNPPSKEAYV       180
     ALLNRGIFLI FLGFLYKFII AYLVNKHFVV PLDIAITHNV DTTTSLIGYM YAYSMYLFFD       240
     FAGYSAFAVG VSYLLGVQTP MNFNKPFAAR NIKEFWNRWH MTLSFWFRDY VFMRFVLWLT       300
     KKKWFKSKFT IAYIAYFVNF FIMGVWHGLH WYYIVYGLYQ ATLIVGFDLI ERFNKKHKFY       360
     PKNKITYVIG VIITFQFVCF GFLIFSGILD KINF                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page