(data stored in ACNUC9435 zone)

EMBL: AL596167.DLTD

AL596167.DLTD        Location/Qualifiers
FT   CDS             complement(28921..30195)
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /product="DltD protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q92D50"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D50"
FT                   /protein_id="CAC96201.1"
FT                   /translation="MKKKLWMTFGPLLVAFAVFLFVLFGPSSLFSYVSSETVEKSATSM
FT                   NEYVIQGLDIQKEALKEGNYLPIYGSSELSRVDPFHPSVVSKKYDQGYTPFLLGRPGTQ
FT                   SLSHFLDVNALGDDLRGKKVAVVLSPQWFQPKGVSDPSFGANFSPLHAYKFALEDAKNT
FT                   PERRYAAKRLLSFQVVQSDSTLKKLLENIVAKGPKKPHDPKLVKLAGNVELKILERKDD
FT                   LESKTVSGSKQDRIEKGLKDLPEKLDYKQLDDLAKETGEKSIGDNPFQVKEKYYQKKIK
FT                   PIEGKLKDSRKDLRYDESPEFGDLQLLMDAFKKAGADVIFINPPINGKWIDYIGMNKQG
FT                   LDGYYAKTKQQIESQGFRYYSLEQYQNDSFFLEDPIHLSWRGWVKIDQVLADFVKAPVQ
FT                   TNYTPTVDDYYIKSHPDNGPKKIQK"
     MKKKLWMTFG PLLVAFAVFL FVLFGPSSLF SYVSSETVEK SATSMNEYVI QGLDIQKEAL        60
     KEGNYLPIYG SSELSRVDPF HPSVVSKKYD QGYTPFLLGR PGTQSLSHFL DVNALGDDLR       120
     GKKVAVVLSP QWFQPKGVSD PSFGANFSPL HAYKFALEDA KNTPERRYAA KRLLSFQVVQ       180
     SDSTLKKLLE NIVAKGPKKP HDPKLVKLAG NVELKILERK DDLESKTVSG SKQDRIEKGL       240
     KDLPEKLDYK QLDDLAKETG EKSIGDNPFQ VKEKYYQKKI KPIEGKLKDS RKDLRYDESP       300
     EFGDLQLLMD AFKKAGADVI FINPPINGKW IDYIGMNKQG LDGYYAKTKQ QIESQGFRYY       360
     SLEQYQNDSF FLEDPIHLSW RGWVKIDQVL ADFVKAPVQT NYTPTVDDYY IKSHPDNGPK       420
     KIQK                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page