(data stored in ACNUC9435 zone)

EMBL: AL596167.EUTA

AL596167.EUTA        Location/Qualifiers
FT   CDS             189795..191216
FT                   /transl_table=11
FT                   /gene="eutA"
FT                   /note="similar to ethanolamine utilization protein EutA
FT                   (putative chaperonin)"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN3"
FT                   /protein_id="CAC96369.1"
FT                   /translation="MTETILSVGIDLGTSTTQLILSELEIQNMASSFTVPRIVISDKRI
FT                   IFRSEILFTPILADNLIDVDAIRDFVTKEYANAGIKKEEIGMGAVIITGETARKDNASN
FT                   VLDAMSGFAGDFVVATAGPDLESIIAGKGAGAHTYSKENSTCVVNLDIGGGTTNLSLFD
FT                   RGELIDTACLDIGGRLIKVDRETRKITYIAPKIQALIEKRGYPITLGEKTSPENLQPIL
FT                   GEMVELLKNSVGLGAPNDFYETIITNKGLKFLAEIECISFSGGVADCISTGALSDPFRY
FT                   GDIGLLLGKSIAESSLMTEKKYIESVETIRATVVGAGSHTAEISGSTITYTEKIFPVKN
FT                   IPILKLAKQEENENMAEVIKEKLNWFKIDEDMERIALAIEGENSPSFQQVTEYAKAICE
FT                   GMKEPISLGHPLIIITWHDMAKALGQSIFGHLPAGYPLICLDSVKVDNGDYIDIGKPVA
FT                   DGKVLPVVVKTLVFN"
     MTETILSVGI DLGTSTTQLI LSELEIQNMA SSFTVPRIVI SDKRIIFRSE ILFTPILADN        60
     LIDVDAIRDF VTKEYANAGI KKEEIGMGAV IITGETARKD NASNVLDAMS GFAGDFVVAT       120
     AGPDLESIIA GKGAGAHTYS KENSTCVVNL DIGGGTTNLS LFDRGELIDT ACLDIGGRLI       180
     KVDRETRKIT YIAPKIQALI EKRGYPITLG EKTSPENLQP ILGEMVELLK NSVGLGAPND       240
     FYETIITNKG LKFLAEIECI SFSGGVADCI STGALSDPFR YGDIGLLLGK SIAESSLMTE       300
     KKYIESVETI RATVVGAGSH TAEISGSTIT YTEKIFPVKN IPILKLAKQE ENENMAEVIK       360
     EKLNWFKIDE DMERIALAIE GENSPSFQQV TEYAKAICEG MKEPISLGHP LIIITWHDMA       420
     KALGQSIFGH LPAGYPLICL DSVKVDNGDY IDIGKPVADG KVLPVVVKTL VFN              473
//

If you have problems or comments...

PBIL Back to PBIL home page