(data stored in ACNUC9435 zone)

EMBL: AL596167.GBUA

AL596167.GBUA        Location/Qualifiers
FT   CDS             70436..71629
FT                   /transl_table=11
FT                   /gene="gbuA"
FT                   /note="highly similar to glycine betaine ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q92D08"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D08"
FT                   /protein_id="CAC96244.1"
FT                   /translation="MSKIKVEELTKIFGKKASKASSLLSQGKSKTEILKETGATIGVNK
FT                   ASFSVEEGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGKIWLDGKELSSLNKKELLEVRR
FT                   KSMSMVFQNFGLFPNRTINRNVEYGLEIQGMNKEEREKNAAESLALVGLAGYGEQYPSQ
FT                   LSGGMQQRVGLARALANNPDILLMDEAFSALDPLNRKDMQDQLLDLQDKMKKTIIFITH
FT                   DLDEALRIGDHIMIMRDGSVVQTGSPEEILAHPANEYVEKFIEDVDRSKVYTASNVMIR
FT                   PEIVNFEKDGPRVALKRMREAGTSSVFVVKRNRELVGIVHAAEVSKLVKENITSLETAL
FT                   HSDVPTTGPDTPLAEIMDTISTTTIPIAVTEDGKLKGIIIRGSVLAALSGNEVNVNA"
     MSKIKVEELT KIFGKKASKA SSLLSQGKSK TEILKETGAT IGVNKASFSV EEGEIFVIMG        60
     LSGSGKSTLV RLLNRLIEPT SGKIWLDGKE LSSLNKKELL EVRRKSMSMV FQNFGLFPNR       120
     TINRNVEYGL EIQGMNKEER EKNAAESLAL VGLAGYGEQY PSQLSGGMQQ RVGLARALAN       180
     NPDILLMDEA FSALDPLNRK DMQDQLLDLQ DKMKKTIIFI THDLDEALRI GDHIMIMRDG       240
     SVVQTGSPEE ILAHPANEYV EKFIEDVDRS KVYTASNVMI RPEIVNFEKD GPRVALKRMR       300
     EAGTSSVFVV KRNRELVGIV HAAEVSKLVK ENITSLETAL HSDVPTTGPD TPLAEIMDTI       360
     STTTIPIAVT EDGKLKGIII RGSVLAALSG NEVNVNA                                397
//

If you have problems or comments...

PBIL Back to PBIL home page