(data stored in ACNUC9435 zone)

EMBL: AL596167.GBUC

AL596167.GBUC        Location/Qualifiers
FT   CDS             72484..73386
FT                   /transl_table=11
FT                   /gene="gbuC"
FT                   /note="highly similar to glycine betaine ABC transporters
FT                   (glycine betaine-binding protein)"
FT                   /db_xref="GOA:Q92D06"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D06"
FT                   /protein_id="CAC96246.1"
FT                   /translation="MLKKLITTAVLAMLIFTLAACGTTLAPYDAKKDLGEQINYTITGI
FT                   DAGAGIMLATQNAIKDYHLDDDNWQLQTSSTAAMTSTLQKAMKDKRPIVVTGWTPHWMF
FT                   TKFDLKFLDDPKNVFGNAENIHTIVRKGLKEEKPSAYKVLDNFFWTAEDMSEVMLEVND
FT                   GVDPEEAAKKWIKNNPEKVAKWTDGVEKVDGDEIKLTYVAWDSEIASTNVVAEALKQVG
FT                   YKPTIQAMEIQPMWASVATDAADGMVAAWLPNTSGIYYKDYKGKFEDLGPNLKGAKIGL
FT                   AVPKYMTNINSIEDLKISK"
     MLKKLITTAV LAMLIFTLAA CGTTLAPYDA KKDLGEQINY TITGIDAGAG IMLATQNAIK        60
     DYHLDDDNWQ LQTSSTAAMT STLQKAMKDK RPIVVTGWTP HWMFTKFDLK FLDDPKNVFG       120
     NAENIHTIVR KGLKEEKPSA YKVLDNFFWT AEDMSEVMLE VNDGVDPEEA AKKWIKNNPE       180
     KVAKWTDGVE KVDGDEIKLT YVAWDSEIAS TNVVAEALKQ VGYKPTIQAM EIQPMWASVA       240
     TDAADGMVAA WLPNTSGIYY KDYKGKFEDL GPNLKGAKIG LAVPKYMTNI NSIEDLKISK       300
//

If you have problems or comments...

PBIL Back to PBIL home page