(data stored in ACNUC9435 zone)

EMBL: AL596167.GLPF

AL596167.GLPF        Location/Qualifiers
FT   CDS             181739..182443
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /note="similar to glycerol uptake facilitator protein"
FT                   /db_xref="GOA:Q92CP0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP0"
FT                   /protein_id="CAC96362.1"
FT                   /translation="MSAYLAEFIGTMVLIMFGNGLLAGLTLNKSLSQGANWVVVTFGWG
FT                   FAVMIGIYVAGAYSGAHLNPAVTIALAVGGSFSWAAVVPYIIAQIAGAFVGASIIILHY
FT                   YPHFKATPQEIDTHGIFSTGPAIRNTPFNLISEIIATFAFIFGLLMIGENSFTNGLNPL
FT                   ILGFLVVAIGMSFGPTTGYAINPARDLGPRLAYFLLPVPNKSGSDWRYAWIPIVGPIIG
FT                   GLLAIGLFNILL"
     MSAYLAEFIG TMVLIMFGNG LLAGLTLNKS LSQGANWVVV TFGWGFAVMI GIYVAGAYSG        60
     AHLNPAVTIA LAVGGSFSWA AVVPYIIAQI AGAFVGASII ILHYYPHFKA TPQEIDTHGI       120
     FSTGPAIRNT PFNLISEIIA TFAFIFGLLM IGENSFTNGL NPLILGFLVV AIGMSFGPTT       180
     GYAINPARDL GPRLAYFLLP VPNKSGSDWR YAWIPIVGPI IGGLLAIGLF NILL             234
//

If you have problems or comments...

PBIL Back to PBIL home page