(data stored in ACNUC9435 zone)

EMBL: AL596167.LEMA

AL596167.LEMA        Location/Qualifiers
FT   CDS             21794..22351
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /product="Listeria epitope LemA"
FT                   /db_xref="GOA:Q92D59"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D59"
FT                   /protein_id="CAC96192.1"
FT                   /translation="MIGWIIAIAVVVILVLIYFGLYNSLVKYRNRVDETWAQIDVQLKR
FT                   RFDLIPNLVETVKGYATHEKETLTQVIEARNKMMEVPADNRQGQIEADNMLSGALKSIF
FT                   ALGEAYPDLKANTSFIELQHELTTTENKVAYSRQLYNTTVMTYNTKVQSVPTNIVAKLH
FT                   NFKERDMLSIPEVERVAPKVEF"
     MIGWIIAIAV VVILVLIYFG LYNSLVKYRN RVDETWAQID VQLKRRFDLI PNLVETVKGY        60
     ATHEKETLTQ VIEARNKMME VPADNRQGQI EADNMLSGAL KSIFALGEAY PDLKANTSFI       120
     ELQHELTTTE NKVAYSRQLY NTTVMTYNTK VQSVPTNIVA KLHNFKERDM LSIPEVERVA       180
     PKVEF                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page