(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0937

AL596167.LIN0937     Location/Qualifiers
FT   CDS             complement(1351..1809)
FT                   /transl_table=11
FT                   /gene="lin0937"
FT                   /note="similar to protein-tyrosine-phosphatase"
FT                   /db_xref="GOA:Q92D81"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D81"
FT                   /protein_id="CAC96168.1"
FT                   /translation="MVKVVFVCLGNICRSPMAEGLFRKEVANAGLTDEIEIDSAATGTW
FT                   NLGKPPHRGTREVLKKHGINYEAMRARKVTDADFEQADYIIGMDQNNIADLNALNKNKD
FT                   VTLRSLMSFVSGKEEEEIPDPYYTGDFDETERMVTEGVKALLAFITKK"
     MVKVVFVCLG NICRSPMAEG LFRKEVANAG LTDEIEIDSA ATGTWNLGKP PHRGTREVLK        60
     KHGINYEAMR ARKVTDADFE QADYIIGMDQ NNIADLNALN KNKDVTLRSL MSFVSGKEEE       120
     EIPDPYYTGD FDETERMVTE GVKALLAFIT KK                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page