(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0941

AL596167.LIN0941     Location/Qualifiers
FT   CDS             complement(3742..5436)
FT                   /transl_table=11
FT                   /gene="lin0941"
FT                   /note="similar to heat shock protein HtpG"
FT                   /db_xref="GOA:Q92D78"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D78"
FT                   /protein_id="CAC96172.1"
FT                   /translation="MENYSHRFQVNLAGMIDILSNHLYDEKDVYIRELLQNATDAIRAR
FT                   KKIEPTLNGKIHVSLSGEKNNKTLILEDNGIGLTEDEVHAFLATIANSSKGEKNFDGQD
FT                   TNDFIGRFGIGLLSCFIVSDEIVMISTSQKNGETTEWHGKADGTYSVRKIKTEKREPGT
FT                   QVYLRLRPHMDEHPECEKTEYLINTLKKYGSSLESAILIEADGYEQEINSWTKQFADKE
FT                   ILFSLPREQILRYGEHLLGTRFQDYFLIENESGRTFGIAFMIPYTVQMNAVRKQTVFLN
FT                   NMYVTSEANNVLPNWAFFAECILWTDELQPVASRESFYKNERLEIVSKELGVALKKGIE
FT                   TLPESALTKLLSTHYLGFKALASEDAPFLKLIYSYLPFKTLNGEEKLADIMKETTTIYY
FT                   TFSVDDFRQITDIARSSGMTLINGGYSYDTPILTMLNHLVDEAEFILIQPEEITNKLLP
FT                   MSAEEEITYQPILAEMNKMMAEFDADITIKHFEPKTLPIIFIHSAATQASRELERSLEE
FT                   TSSVFSDILESIQQEQAPAPLAHLYLNLDNELIKNFSRLVNLLMSYR"
     MENYSHRFQV NLAGMIDILS NHLYDEKDVY IRELLQNATD AIRARKKIEP TLNGKIHVSL        60
     SGEKNNKTLI LEDNGIGLTE DEVHAFLATI ANSSKGEKNF DGQDTNDFIG RFGIGLLSCF       120
     IVSDEIVMIS TSQKNGETTE WHGKADGTYS VRKIKTEKRE PGTQVYLRLR PHMDEHPECE       180
     KTEYLINTLK KYGSSLESAI LIEADGYEQE INSWTKQFAD KEILFSLPRE QILRYGEHLL       240
     GTRFQDYFLI ENESGRTFGI AFMIPYTVQM NAVRKQTVFL NNMYVTSEAN NVLPNWAFFA       300
     ECILWTDELQ PVASRESFYK NERLEIVSKE LGVALKKGIE TLPESALTKL LSTHYLGFKA       360
     LASEDAPFLK LIYSYLPFKT LNGEEKLADI MKETTTIYYT FSVDDFRQIT DIARSSGMTL       420
     INGGYSYDTP ILTMLNHLVD EAEFILIQPE EITNKLLPMS AEEEITYQPI LAEMNKMMAE       480
     FDADITIKHF EPKTLPIIFI HSAATQASRE LERSLEETSS VFSDILESIQ QEQAPAPLAH       540
     LYLNLDNELI KNFSRLVNLL MSYR                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page