(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0943

AL596167.LIN0943     Location/Qualifiers
FT   CDS             6343..6645
FT                   /transl_table=11
FT                   /gene="lin0943"
FT                   /note="similar to B. subtilis YneR protein"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR008326"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D77"
FT                   /protein_id="CAC96174.1"
FT                   /translation="MNIEVTDQANKWFHDEFDVADGNGIRLFAKYGGSNSSLHPGFSIG
FT                   LAAEKPQEAAVAEKKEDLTFFIEDHDYWYFKDHDWKIDYEPKTEEVSFSFKEKVK"
     MNIEVTDQAN KWFHDEFDVA DGNGIRLFAK YGGSNSSLHP GFSIGLAAEK PQEAAVAEKK        60
     EDLTFFIEDH DYWYFKDHDW KIDYEPKTEE VSFSFKEKVK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page