(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0944

AL596167.LIN0944     Location/Qualifiers
FT   CDS             6760..7890
FT                   /transl_table=11
FT                   /gene="lin0944"
FT                   /note="similar to C-terminal part of B. subtilis ComEC
FT                   protein and to ComEA "
FT                   /db_xref="GOA:Q92D76"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D76"
FT                   /protein_id="CAC96175.1"
FT                   /translation="MTKKLVICISLIAIFLSGCSFSEPSTKPSNITEKTLNGASFTFFD
FT                   VGQGDSTLIQAEDGTTILIDTGRQDDDRILTYLKEANIKKLDLLLLTHPHADHIGNADK
FT                   VIATYKPKEIWMDGLTFSSSIYEKVIDAALASNAKYKEPRRGDKATFGPFDIEVLSPDK
FT                   LQNDANNDSIAVKMTYKDISAIFTGDAEKGREREMADSGANLEADILDLGHHGSSTSNQ
FT                   PFFLDKVKPQVAVYSAEMANSYGHPHVEVLEWLKERDIKTYGTDVNGTITIETDGEKIH
FT                   VQTEKEGTPKPGSSYNKENNTQKTEDATSEELPESINLNSASSEELQLLPLIGPALAEK
FT                   IIAERPYQSIDELKKINGIGDGIVRQIKEQGLAVTK"
     MTKKLVICIS LIAIFLSGCS FSEPSTKPSN ITEKTLNGAS FTFFDVGQGD STLIQAEDGT        60
     TILIDTGRQD DDRILTYLKE ANIKKLDLLL LTHPHADHIG NADKVIATYK PKEIWMDGLT       120
     FSSSIYEKVI DAALASNAKY KEPRRGDKAT FGPFDIEVLS PDKLQNDANN DSIAVKMTYK       180
     DISAIFTGDA EKGREREMAD SGANLEADIL DLGHHGSSTS NQPFFLDKVK PQVAVYSAEM       240
     ANSYGHPHVE VLEWLKERDI KTYGTDVNGT ITIETDGEKI HVQTEKEGTP KPGSSYNKEN       300
     NTQKTEDATS EELPESINLN SASSEELQLL PLIGPALAEK IIAERPYQSI DELKKINGIG       360
     DGIVRQIKEQ GLAVTK                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page