(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0946

AL596167.LIN0946     Location/Qualifiers
FT   CDS             complement(8326..9543)
FT                   /transl_table=11
FT                   /gene="lin0946"
FT                   /note="hypothetical transport protein"
FT                   /db_xref="GOA:Q92D74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D74"
FT                   /protein_id="CAC96177.1"
FT                   /translation="MNSDLTNKKILTRSSRVMLIVGIILIAANLRAPITSVGPLLGMIQ
FT                   SDLHLTNTMAGLLTTIPLLAFAGLSPFVSKLSRSLGIEVLIFIALLTLVIGSLLRPFGG
FT                   EFYLFAGTFMIGLAIAVGNVILPSLIKKEFPFKLGLMTGVYSISMNLCAALAAGLTVPI
FT                   AMNNKFSWHGSMVFWAMLGVLALVIWLPQLRYNQRSSEKIATHLVTTSVWKSPLAWKIS
FT                   LYMGSQSAIFYISIAWLPNILADQGLSSTSSGLMLSLMQFAVMPITFIIPIIAGRMKNQ
FT                   QLLVGISVLLFMIGIFGIMFASGNLFILATAIILYGIGSGMSFSLSMMFFNLRTTSATE
FT                   SADLSGMAQSIGYLFAASGPILFGTLHDALGSWQPTLYVLIGITLIMLYCGLDAGRNKF
FT                   LFPQKK"
     MNSDLTNKKI LTRSSRVMLI VGIILIAANL RAPITSVGPL LGMIQSDLHL TNTMAGLLTT        60
     IPLLAFAGLS PFVSKLSRSL GIEVLIFIAL LTLVIGSLLR PFGGEFYLFA GTFMIGLAIA       120
     VGNVILPSLI KKEFPFKLGL MTGVYSISMN LCAALAAGLT VPIAMNNKFS WHGSMVFWAM       180
     LGVLALVIWL PQLRYNQRSS EKIATHLVTT SVWKSPLAWK ISLYMGSQSA IFYISIAWLP       240
     NILADQGLSS TSSGLMLSLM QFAVMPITFI IPIIAGRMKN QQLLVGISVL LFMIGIFGIM       300
     FASGNLFILA TAIILYGIGS GMSFSLSMMF FNLRTTSATE SADLSGMAQS IGYLFAASGP       360
     ILFGTLHDAL GSWQPTLYVL IGITLIMLYC GLDAGRNKFL FPQKK                       405
//

If you have problems or comments...

PBIL Back to PBIL home page