(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0948

AL596167.LIN0948     Location/Qualifiers
FT   CDS             10351..11397
FT                   /transl_table=11
FT                   /gene="lin0948"
FT                   /note="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:Q92D72"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D72"
FT                   /protein_id="CAC96179.1"
FT                   /translation="MNWLEKLKENDTARRVLVFVLLGIVLYLLRSMIDLILLTFIFAFL
FT                   VTRLENVILKRIRIPRKLIVIVLYCLVAMFLYVAIVHFLPILIDQISQLVDSLVKIYNN
FT                   PSDNKIVQWIVGFLKESNIQKYLQTGVDFIIASLSGIGSVGLSFFLALILSLFFSLEKE
FT                   RVTSFTGQFLTSKVGFIFKEAAFFGKKFVATFGVVLEAQLMIALVNTIITTIALYLMNF
FT                   PQLLSLSIMVFVLGLIPVAGVIISCVPLVLIAYSVGGFQDVVYILITVVIVHAIETYIL
FT                   NPKLMSSKTNLPVFYTFIILIFSETFFGVWGLIVGIPVFVFLLDILDVRNSEDIQKRTI
FT                   FGRKKKVD"
     MNWLEKLKEN DTARRVLVFV LLGIVLYLLR SMIDLILLTF IFAFLVTRLE NVILKRIRIP        60
     RKLIVIVLYC LVAMFLYVAI VHFLPILIDQ ISQLVDSLVK IYNNPSDNKI VQWIVGFLKE       120
     SNIQKYLQTG VDFIIASLSG IGSVGLSFFL ALILSLFFSL EKERVTSFTG QFLTSKVGFI       180
     FKEAAFFGKK FVATFGVVLE AQLMIALVNT IITTIALYLM NFPQLLSLSI MVFVLGLIPV       240
     AGVIISCVPL VLIAYSVGGF QDVVYILITV VIVHAIETYI LNPKLMSSKT NLPVFYTFII       300
     LIFSETFFGV WGLIVGIPVF VFLLDILDVR NSEDIQKRTI FGRKKKVD                    348
//

If you have problems or comments...

PBIL Back to PBIL home page