(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0962

AL596167.LIN0962     Location/Qualifiers
FT   CDS             22374..23288
FT                   /transl_table=11
FT                   /gene="lin0962"
FT                   /note="similar to putative heat shock protein HtpX,
FT                   Listeria epitope LemB"
FT                   /db_xref="GOA:Q92D58"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D58"
FT                   /protein_id="CAC96193.1"
FT                   /translation="MLFEQIAANKRKTVFIILGFFIFVLMVGAAIGIIVWNNYLNGLIL
FT                   AAAIGAVYILIMVMSSSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIV
FT                   EDPSPNAFATGISPEKGAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIAL
FT                   VAVIAILSDLAMRLIFWGSLTGGRNSRKSDNNNGGGAQIIIYVVALIFVILAPIIATAI
FT                   QFALSRNREYLADASAVELTRNPDGLIQALQKISGDTKKMEEVSASSESIYFSSPLKSK
FT                   KDKPGLFDSHPPISSRIERLENM"
     MLFEQIAANK RKTVFIILGF FIFVLMVGAA IGIIVWNNYL NGLILAAAIG AVYILIMVMS        60
     SSSVVMAMNH AKEVTSKEQA PVLWDTVESM AMVAGIPMPK VYIVEDPSPN AFATGISPEK       120
     GAVAVTRGLL NKLERYELEG VIAHEISHIR NYDIRLSTIA IALVAVIAIL SDLAMRLIFW       180
     GSLTGGRNSR KSDNNNGGGA QIIIYVVALI FVILAPIIAT AIQFALSRNR EYLADASAVE       240
     LTRNPDGLIQ ALQKISGDTK KMEEVSASSE SIYFSSPLKS KKDKPGLFDS HPPISSRIER       300
     LENM                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page