(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0964

AL596167.LIN0964     Location/Qualifiers
FT   CDS             complement(24393..24977)
FT                   /transl_table=11
FT                   /gene="lin0964"
FT                   /note="similar to B. subtilis YjbK protein"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D56"
FT                   /protein_id="CAC96195.1"
FT                   /translation="MVKELEIEFRNLLTKEEYDRLIEDFRIKEDDFFEQTNFYLDTADF
FT                   GLKERNSALRIRKLETQYQLTLKTPEARGLMETTQILAADQATAITDGANIPVGPVRDT
FT                   LKEIGINHEDLQVFGSLKTIRAEKDYKKGLLVFDKNFYGSISDFDLEYEVSDYDKGKEI
FT                   FDKLLKEYQITNHPAENKVARFYNHVYKNND"
     MVKELEIEFR NLLTKEEYDR LIEDFRIKED DFFEQTNFYL DTADFGLKER NSALRIRKLE        60
     TQYQLTLKTP EARGLMETTQ ILAADQATAI TDGANIPVGP VRDTLKEIGI NHEDLQVFGS       120
     LKTIRAEKDY KKGLLVFDKN FYGSISDFDL EYEVSDYDKG KEIFDKLLKE YQITNHPAEN       180
     KVARFYNHVY KNND                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page